PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_2150V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 434aa    MW: 46727 Da    PI: 6.8523
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_2150V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-172873147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEd  l ++v+++G ++W++Iar ++ gR++k+c++rw + 
  Pp3c5_2150V3.2.p 28 KGPWSPEEDVVLNRLVEKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 73
                      79******************************.***********985 PP

2Myb_DNA-binding58.91.2e-1880124147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r+++T+eEd  +v a++ +G++ W++Iar+++ gRt++ +k++w++ 
  Pp3c5_2150V3.2.p  80 RKPFTEEEDRAIVAAHAIHGNK-WASIARMLP-GRTDNAIKNHWNST 124
                       789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.7522374IPR017930Myb domain
SuperFamilySSF466895.39E-3126121IPR009057Homeodomain-like
SMARTSM007171.2E-142776IPR001005SANT/Myb domain
PfamPF002493.7E-162873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-262981IPR009057Homeodomain-like
CDDcd001677.04E-143072No hitNo description
PROSITE profilePS5129428.0675129IPR017930Myb domain
SMARTSM007175.3E-1879127IPR001005SANT/Myb domain
PfamPF002496.1E-1680124IPR001005SANT/Myb domain
CDDcd001679.94E-1482125No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2482128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MDVSPEVSGG GTRLKGAAGG AGTDDRIKGP WSPEEDVVLN RLVEKFGARN WSLIARGIPG  60
RSGKSCRLRW CNQLNPGVKR KPFTEEEDRA IVAAHAIHGN KWASIARMLP GRTDNAIKNH  120
WNSTLRRKHM GDDRGRKEGS SDGSEKGKED GSDTERTPPG RDNDNDMGDD SGRDYDGDDF  180
AVSSDTPHSW PPHTSEKTVA GEIIMDGRSH LRSNQLERDS QHDVPASASA KSPEGKPIRP  240
VPRPSAFSWY RKVGANMSFV EPGSPSVSLS SHGDGGALNP TTVSSFMPPF WNWSMPEAPS  300
NCGRGCCPPQ PSGRPAETSI SPKGPLMGPD YVEFGEDGFA AVAPTVATMQ ANFATLNYTS  360
ATSQLLSSAI HAAVAEIVVP MLQGQVKQVT ESFLAVEKDC RSSSRLDMGL MREIVAQEIS  420
RYTSMRVPEP SSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-41221281107B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.116140.0protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S72_143V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.14e-61myb domain protein 109